PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Seita.7G223500.1.p
Common NameLOC101768861, SETIT_010794mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family G2-like
Protein Properties Length: 279aa    MW: 30743.2 Da    PI: 9.462
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Seita.7G223500.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like106.91.1e-331973155
             G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                        kprlrWtp+LH+rFv+av++LGG++kAtPk++l+lm++kgLtl+h+kSHLQkYRl
  Seita.7G223500.1.p 19 KPRLRWTPDLHQRFVDAVDKLGGPDKATPKSVLRLMGMKGLTLYHLKSHLQKYRL 73
                        79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.5E-321674IPR009057Homeodomain-like
PROSITE profilePS5129413.8911676IPR017930Myb domain
SuperFamilySSF466891.43E-161974IPR009057Homeodomain-like
TIGRFAMsTIGR015574.6E-251974IPR006447Myb domain, plants
PfamPF002491.1E-92172IPR001005SANT/Myb domain
PfamPF143791.8E-21117163IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 279 aa     Download sequence    Send to blast
MMEGRYGGGG GGAMSRDPKP RLRWTPDLHQ RFVDAVDKLG GPDKATPKSV LRLMGMKGLT  60
LYHLKSHLQK YRLGKQGKKS TGLELANGGG FAAPGLSFPT PTPIPGVPAE GKNTGEMPLA  120
DALRYQIQVQ RKLQEQLEVQ KKLQMRIEAQ GKYLKAILEK AERNISSDVN APSDNIESTR  180
SQLMDFNLAL SGFMDNATRV CEENNEQLVK ALSDDKHKDN NLGFQLYQVG CQGAKEVKWT  240
PKTEDLLQLD LNIKGGYDLS SRGMQACEVD LKINQQMI*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004976682.10.0PREDICTED: myb family transcription factor APL-like
SwissprotQ9SAK54e-47APL_ARATH; Myb family transcription factor APL
TrEMBLK3Y9A20.0K3Y9A2_SETIT; Uncharacterized protein
STRINGSi010794m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP39403470
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G45580.11e-53G2-like family protein